PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25993s0196.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 780aa    MW: 85430.8 Da    PI: 6.6925
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25993s0196.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.6e-2195150156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe++F+++++p++++r +L+++l+L+ rqVk+WFqNrR+++k
  Bostr.25993s0196.2.p  95 KKRYHRHTPQQIQELESVFKECPHPDEKQRLDLSRRLNLDSRQVKFWFQNRRTQMK 150
                           688999***********************************************999 PP

2START182.13.2e-573015271205
                           HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           ela++a++elvk+a+ +ep+W +ss    + +n++e+ ++f++  +     + +ea++++g+v+ ++  lve+l+d+  +W e+++   
  Bostr.25993s0196.2.p 301 ELALSAMDELVKMAQTSEPLWLESSkgkrKLLNREEYEKIFTPCLGpkpdeFVSEASKEVGMVIINSLALVETLMDSE-RWAEMFPcmi 388
                           57899********************99999999********88666999999**************************.********** PP

                           .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEE CS
                 START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgilie 155
                            + +t e issg      gal+lm+aelq+lsplvp R ++f+R+++q+ +g+w++vdvSvd ++++      + +  +++lpSg+l++
  Bostr.25993s0196.2.p 389 aRNSTSEIISSGmggtrnGALHLMQAELQLLSPLVPvRQVTFLRFCKQHAEGVWAVVDVSVDRNSDRGGsasAQTSLSCRRLPSGCLVQ 477
                           *****************************************************************9987777778999*********** PP

                           EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                 START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                           +++ng+skvtw++h+++++ ++h l+r+lv+sgla+g k+w ++lq qc+
  Bostr.25993s0196.2.p 478 DMPNGYSKVTWIDHTEYDDTHIHHLYRPLVSSGLAFGSKRWISALQGQCK 527
                           *************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-2080152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-2183152IPR009057Homeodomain-like
PROSITE profilePS5007117.63792152IPR001356Homeobox domain
SMARTSM003893.2E-1993156IPR001356Homeobox domain
CDDcd000861.96E-1895152No hitNo description
PfamPF000461.3E-1895150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084841.339292531IPR002913START domain
SuperFamilySSF559611.51E-27295528No hitNo description
CDDcd088751.04E-112296526No hitNo description
PfamPF018529.9E-50301527IPR002913START domain
SMARTSM002341.2E-44301528IPR002913START domain
SuperFamilySSF559614.81E-21556771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MDFSGFLHHD DDNSSGGGNH FSSSAAMSGG LAKSIFSSPR LSLGLQTNGE ATRTGESFEV  60
SISRRSPESR SGSDNAEALS GDDDLDASDR PLKKKKRYHR HTPQQIQELE SVFKECPHPD  120
EKQRLDLSRR LNLDSRQVKF WFQNRRTQMK TQIERHENSL LRQENDKLRA ENMSAREAIR  180
NPMCGHCGGS AVLGEISLEE HHLRTENSRL KDELDRICAL AGKFLNRSDD EATGSHQLPN  240
SALKLGVGTN NGYGGGGGGG GFTLVPPGFE ILSPFFSGLA APVNRTTDVA TGLDQKSLYL  300
ELALSAMDEL VKMAQTSEPL WLESSKGKRK LLNREEYEKI FTPCLGPKPD EFVSEASKEV  360
GMVIINSLAL VETLMDSERW AEMFPCMIAR NSTSEIISSG MGGTRNGALH LMQAELQLLS  420
PLVPVRQVTF LRFCKQHAEG VWAVVDVSVD RNSDRGGSAS AQTSLSCRRL PSGCLVQDMP  480
NGYSKVTWID HTEYDDTHIH HLYRPLVSSG LAFGSKRWIS ALQGQCKSLT ILMSSTIPNR  540
DKPTPISSLG KKSMLKLAQR MTQKFCRGVC ASSSQKWSKL EIGNIDEDVR IMTRKNVDDS  600
GEPPGILLSA ATSVWVPVPP RRLFDFLRDE LLRSEWDILS NGGPMQEIAT IFKGQDQSNS  660
VSLLRSTAMN AIQSSMLILQ ETSIDASGAI VVYAPVDIPA MHSVMNGADS AYVALLPSGF  720
AILPDGQGME ENGSLLTVAF QILVNSLPTA KLNVESIETV NNLISCTVQK IRAALRCDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293718.10.0hypothetical protein CARUB_v10022677mg
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FVJ90.0R0FVJ9_9BRAS; Uncharacterized protein
STRINGBra004934.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1